SCOPe 2.05: Domain d4kpta_: 4kpt A:

Lineage for d4kpta_ (4kpt A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:272623] [227880] (4 PDB entries)

8. Domain d4kpta_: 4kpt A: [227882]
   automated match to d3k4ue_
   complexed with ete, mes, p6g, peg, pg4

Details for d4kpta_

PDB Entry: 4kpt, 1.4 Å

PDB Description: Crystal structure of substrate binding domain 1 (SBD1) OF ABC transporter GLNPQ from lactococcus lactis

PDB Compounds: (A:) Glutamine ABC transporter permease and substrate binding protein protein

SCOPe Domain Sequences for d4kpta_:

Sequence; same for both SEQRES and ATOM records:

>d4kpta_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}
tvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlkagqv
dgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaaqtw
lqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsislp
ggygfavmkgknstlvdgfnkalaemksngdydkilkkygita

Timeline for d4kpta_:

• d4kpta_ first appeared in SCOPe 2.03
  
• d4kpta_ appears in SCOPe 2.04
  
• d4kpta_ appears in SCOPe 2.06
  
• d4kpta_ appears in the current release, SCOPe 2.08