SCOPe 2.08: Domain d4j4na1: 4j4n A:7-127

Lineage for d4j4na1 (4j4n A:7-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries)

8. Domain d4j4na1: 4j4n A:7-127 [227877]
   Other proteins in same PDB: d4j4na2, d4j4nb2
   automated match to d2vn1b_
   complexed with d44

Details for d4j4na1

PDB Entry: 4j4n, 2.75 Å

PDB Description: Crystal structure of FK506 binding domain of plasmodium falciparum FKBP35 in complex with D44

PDB Compounds: (A:) FK506-binding protein (FKBP)-type peptidyl-propyl isomerase

SCOPe Domain Sequences for d4j4na1:

Sequence; same for both SEQRES and ATOM records:

>d4j4na1 d.26.1.0 (A:7-127) automated matches {Plasmodium falciparum [TaxId: 36329]}
fekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpfk
fhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsfr
e

Timeline for d4j4na1:

• d4j4na1 first appeared in SCOPe 2.03, called d4j4na_
  
• d4j4na1 appears in SCOPe 2.07