Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries) |
Domain d4j4na1: 4j4n A:7-127 [227877] Other proteins in same PDB: d4j4na2, d4j4nb2 automated match to d2vn1b_ complexed with d44 |
PDB Entry: 4j4n (more details), 2.75 Å
SCOPe Domain Sequences for d4j4na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4na1 d.26.1.0 (A:7-127) automated matches {Plasmodium falciparum [TaxId: 36329]} fekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpfk fhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsfr e
Timeline for d4j4na1: