Lineage for d4j4nb1 (4j4n B:7-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548747Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2548748Protein automated matches [191162] (29 species)
    not a true protein
  7. 2548870Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries)
  8. 2548876Domain d4j4nb1: 4j4n B:7-127 [227876]
    Other proteins in same PDB: d4j4na2, d4j4nb2
    automated match to d2vn1b_
    complexed with d44

Details for d4j4nb1

PDB Entry: 4j4n (more details), 2.75 Å

PDB Description: Crystal structure of FK506 binding domain of plasmodium falciparum FKBP35 in complex with D44
PDB Compounds: (B:) FK506-binding protein (FKBP)-type peptidyl-propyl isomerase

SCOPe Domain Sequences for d4j4nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4nb1 d.26.1.0 (B:7-127) automated matches {Plasmodium falciparum [TaxId: 36329]}
fekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpfk
fhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsfr
e

SCOPe Domain Coordinates for d4j4nb1:

Click to download the PDB-style file with coordinates for d4j4nb1.
(The format of our PDB-style files is described here.)

Timeline for d4j4nb1: