![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (11 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [195450] (2 PDB entries) |
![]() | Domain d4j4nb_: 4j4n B: [227876] automated match to d2vn1b_ complexed with d44 |
PDB Entry: 4j4n (more details), 2.75 Å
SCOPe Domain Sequences for d4j4nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4nb_ d.26.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} fekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpfk fhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsfr el
Timeline for d4j4nb_: