Lineage for d4j4nb_ (4j4n B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408659Species Plasmodium falciparum [TaxId:36329] [195450] (2 PDB entries)
  8. 1408663Domain d4j4nb_: 4j4n B: [227876]
    automated match to d2vn1b_
    complexed with d44

Details for d4j4nb_

PDB Entry: 4j4n (more details), 2.75 Å

PDB Description: Crystal structure of FK506 binding domain of plasmodium falciparum FKBP35 in complex with D44
PDB Compounds: (B:) FK506-binding protein (FKBP)-type peptidyl-propyl isomerase

SCOPe Domain Sequences for d4j4nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4nb_ d.26.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
fekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpfk
fhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsfr
el

SCOPe Domain Coordinates for d4j4nb_:

Click to download the PDB-style file with coordinates for d4j4nb_.
(The format of our PDB-style files is described here.)

Timeline for d4j4nb_: