| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (20 species) not a true protein |
| Species Plasmodium vivax [TaxId:126793] [227874] (2 PDB entries) |
| Domain d4j4oa_: 4j4o A: [227875] automated match to d3ihza_ complexed with d44, gol |
PDB Entry: 4j4o (more details), 1.73 Å
SCOPe Domain Sequences for d4j4oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4oa_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
tleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvpf
kfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielisf
re
Timeline for d4j4oa_: