Lineage for d4j4oa_ (4j4o A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408665Species Plasmodium vivax [TaxId:126793] [227874] (2 PDB entries)
  8. 1408666Domain d4j4oa_: 4j4o A: [227875]
    automated match to d3ihza_
    complexed with d44, gol

Details for d4j4oa_

PDB Entry: 4j4o (more details), 1.73 Å

PDB Description: crystal structure of fk506 binding domain of plasmodium vivax fkbp35 in complex with d44
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putative

SCOPe Domain Sequences for d4j4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4oa_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
tleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvpf
kfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielisf
re

SCOPe Domain Coordinates for d4j4oa_:

Click to download the PDB-style file with coordinates for d4j4oa_.
(The format of our PDB-style files is described here.)

Timeline for d4j4oa_: