SCOPe 2.07: Domain d4iwrb_: 4iwr B:

Lineage for d4iwrb_ (4iwr B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (17 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4iwrb_: 4iwr B: [227873]
   automated match to d3clca_
   protein/DNA complex

Details for d4iwrb_

PDB Entry: 4iwr, 2.4 Å

PDB Description: C.Esp1396I bound to a 25 base pair operator site

PDB Compounds: (B:) Regulatory protein

SCOPe Domain Sequences for d4iwrb_:

Sequence; same for both SEQRES and ATOM records:

>d4iwrb_ a.35.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeilk

Timeline for d4iwrb_:

• d4iwrb_ first appeared in SCOPe 2.03
  
• d4iwrb_ appears in SCOPe 2.06
  
• d4iwrb_ appears in the current release, SCOPe 2.08