Lineage for d4iwra_ (4iwr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2319204Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2319205Protein automated matches [190907] (11 species)
    not a true protein
  7. 2319210Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)
  8. 2319233Domain d4iwra_: 4iwr A: [227872]
    automated match to d3clca_
    protein/DNA complex

Details for d4iwra_

PDB Entry: 4iwr (more details), 2.4 Å

PDB Description: C.Esp1396I bound to a 25 base pair operator site
PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4iwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iwra_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkgle
vsdvvffemlikeil

SCOPe Domain Coordinates for d4iwra_:

Click to download the PDB-style file with coordinates for d4iwra_.
(The format of our PDB-style files is described here.)

Timeline for d4iwra_: