Lineage for d4ipca_ (4ipc A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314615Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1314815Protein automated matches [190206] (4 species)
    not a true protein
  7. 1314825Species Human (Homo sapiens) [TaxId:9606] [186959] (16 PDB entries)
  8. 1314826Domain d4ipca_: 4ipc A: [227867]
    automated match to d4ijha_
    mutant

Details for d4ipca_

PDB Entry: 4ipc (more details), 1.22 Å

PDB Description: Structure of the N-terminal domain of RPA70, E7R mutant
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4ipca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ipca_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne

SCOPe Domain Coordinates for d4ipca_:

Click to download the PDB-style file with coordinates for d4ipca_.
(The format of our PDB-style files is described here.)

Timeline for d4ipca_: