Lineage for d4h1tc_ (4h1t C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888510Species Vibrio cholerae [TaxId:243277] [224899] (19 PDB entries)
  8. 2888591Domain d4h1tc_: 4h1t C: [227862]
    automated match to d4g8jd_
    complexed with cl, edo, eoh, k, na, peg, po4, so4

Details for d4h1tc_

PDB Entry: 4h1t (more details), 1.92 Å

PDB Description: X-RAY Structure of the Complex VchUPh with Phosphate ion at 1.92A Resolution.
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d4h1tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h1tc_ c.56.2.1 (C:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
vvveaarkmlk

SCOPe Domain Coordinates for d4h1tc_:

Click to download the PDB-style file with coordinates for d4h1tc_.
(The format of our PDB-style files is described here.)

Timeline for d4h1tc_: