SCOPe 2.03: Domain d4h1tf_: 4h1t F:

Lineage for d4h1tf_ (4h1t F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (5 species)

7. Species Vibrio cholerae [TaxId:243277] [224899] (2 PDB entries)

8. Domain d4h1tf_: 4h1t F: [227857]
   automated match to d4g8jd_
   complexed with cl, edo, eoh, k, na, peg, po4, so4

Details for d4h1tf_

PDB Entry: 4h1t, 1.92 Å

PDB Description: X-RAY Structure of the Complex VchUPh with Phosphate ion at 1.92A Resolution.

PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d4h1tf_:

Sequence; same for both SEQRES and ATOM records:

>d4h1tf_ c.56.2.1 (F:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
vvveaarkml

Timeline for d4h1tf_:

• d4h1tf_ is new in SCOPe 2.03-stable
  
• d4h1tf_ appears in SCOPe 2.04
  
• d4h1tf_ appears in the current release, SCOPe 2.08