Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (11 species) not a true protein |
Species Staphylococcus phage [TaxId:12360] [227850] (1 PDB entry) |
Domain d4gv8e_: 4gv8 E: [227851] automated match to d2hqua_ complexed with dup, mg |
PDB Entry: 4gv8 (more details), 2.1 Å
SCOPe Domain Sequences for d4gv8e_:
Sequence, based on SEQRES records: (download)
>d4gv8e_ b.85.4.0 (E:) automated matches {Staphylococcus phage [TaxId: 12360]} tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair qygtyqinegdklaqlvivpiwtpelkqveefesvsergekgf
>d4gv8e_ b.85.4.0 (E:) automated matches {Staphylococcus phage [TaxId: 12360]} tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair qygtyqinegdklaqlvivpiwtpelkqveefef
Timeline for d4gv8e_: