SCOPe 2.04: Domain d4gv8e_: 4gv8 E:

Lineage for d4gv8e_ (4gv8 E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (11 species)
   not a true protein

7. Species Staphylococcus phage [TaxId:12360] [227850] (1 PDB entry)

8. Domain d4gv8e_: 4gv8 E: [227851]
   automated match to d2hqua_
   complexed with dup, mg

Details for d4gv8e_

PDB Entry: 4gv8, 2.1 Å

PDB Description: dutpase from phage phi11 of s.aureus: visualization of the species- specific insert

PDB Compounds: (E:) dutpase

SCOPe Domain Sequences for d4gv8e_:

Sequence, based on SEQRES records:

>d4gv8e_ b.85.4.0 (E:) automated matches {Staphylococcus phage [TaxId: 12360]}
tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair
qygtyqinegdklaqlvivpiwtpelkqveefesvsergekgf

Sequence, based on observed residues (ATOM records):

>d4gv8e_ b.85.4.0 (E:) automated matches {Staphylococcus phage [TaxId: 12360]}
tntlqvrllsenarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagyhgnlginikndaiasngyitpgvfdikgeidlsdair
qygtyqinegdklaqlvivpiwtpelkqveefef

Timeline for d4gv8e_:

• d4gv8e_ first appeared in SCOPe 2.03
  
• d4gv8e_ appears in SCOPe 2.05
  
• d4gv8e_ appears in the current release, SCOPe 2.08