Lineage for d4gpga_ (4gpg A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064172Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2064173Protein Achromobacter protease [50496] (1 species)
  7. 2064174Species Achromobacter lyticus, strain m497-1 [TaxId:224] [50497] (3 PDB entries)
  8. 2064176Domain d4gpga_: 4gpg A: [227846]
    automated match to d1arba_
    complexed with dod

Details for d4gpga_

PDB Entry: 4gpg (more details), 1.9 Å

PDB Description: x/n joint refinement of achromobacter lyticus protease i free form at pd8.0
PDB Compounds: (A:) Protease 1

SCOPe Domain Sequences for d4gpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpga_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]}
gvsgscnidvvcpegdgrrdiiravgaysksgtlactgslvnntandrkmyfltahhcgm
gtastaasivvywnyqnstcrapntpasgangdgsmsqtqsgstvkatyatsdftlleln
naanpafnlfwagwdrrdqnypgaiaihhpnvaekrisnstsptsfvawgggagtthlnv
qwqpsggvtepgssgspiyspekrvlgqlhggpsscsatgtnrsdqygrvftswtgggaa
asrlsdwldpastgaqfidglds

SCOPe Domain Coordinates for d4gpga_:

Click to download the PDB-style file with coordinates for d4gpga_.
(The format of our PDB-style files is described here.)

Timeline for d4gpga_: