Lineage for d4c45a_ (4c45 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958013Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2958014Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2958053Protein automated matches [191183] (3 species)
    not a true protein
  7. 2958054Species Human (Homo sapiens) [TaxId:9606] [227841] (1 PDB entry)
  8. 2958055Domain d4c45a_: 4c45 A: [227842]
    automated match to d3hxaa_
    complexed with edo

Details for d4c45a_

PDB Entry: 4c45 (more details), 1.45 Å

PDB Description: crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2)
PDB Compounds: (A:) pterin-4-alpha-carbinolamine dehydratase 2

SCOPe Domain Sequences for d4c45a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c45a_ d.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thrltaeernqaildlkaagwselserdaiykefsfhnfnqafgfmsrvalqaekmnhhp
ewfnvynkvqitltshdcgeltkkdvklakfiekaaasv

SCOPe Domain Coordinates for d4c45a_:

Click to download the PDB-style file with coordinates for d4c45a_.
(The format of our PDB-style files is described here.)

Timeline for d4c45a_: