Lineage for d4c2sb_ (4c2s B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1381405Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1381406Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1381787Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 1381900Protein automated matches [190178] (2 species)
    not a true protein
  7. 1381907Species Human (Homo sapiens) [TaxId:9606] [186910] (36 PDB entries)
  8. 1381953Domain d4c2sb_: 4c2s B: [227840]
    automated match to d2rj7a_
    complexed with mn, udp; mutant

Details for d4c2sb_

PDB Entry: 4c2s (more details), 2.48 Å

PDB Description: crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta p156l mutant) in complex with udp and deoxy-h-antigen acceptor
PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d4c2sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2sb_ c.68.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqlaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrn

SCOPe Domain Coordinates for d4c2sb_:

Click to download the PDB-style file with coordinates for d4c2sb_.
(The format of our PDB-style files is described here.)

Timeline for d4c2sb_: