| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
| Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
| Protein automated matches [190178] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries) |
| Domain d4c2sa1: 4c2s A:64-353 [227839] Other proteins in same PDB: d4c2sa2 automated match to d2rj7a_ complexed with mn, udp; mutant |
PDB Entry: 4c2s (more details), 2.48 Å
SCOPe Domain Sequences for d4c2sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2sa1 c.68.1.9 (A:64-353) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqlaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrn
Timeline for d4c2sa1: