Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (23 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries) |
Domain d4bn0a_: 4bn0 A: [227832] automated match to d4f2pb_ mutant |
PDB Entry: 4bn0 (more details), 2.11 Å
SCOPe Domain Sequences for d4bn0a_:
Sequence, based on SEQRES records: (download)
>d4bn0a_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} hmvqkigilgamreqitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhst ltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesa ifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegas vafvcqkfgvpccvlrsisdnadeeanmsfdafleksaqtsakflksmvdel
>d4bn0a_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} hmvqkigilgamreqitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhst ltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesa ifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegas vafvcqkfgvpccvlrsisdnsfdafleksaqtsakflksmvdel
Timeline for d4bn0a_: