Lineage for d4bmxa_ (4bmx A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1861590Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1861591Protein automated matches [190781] (36 species)
    not a true protein
  7. 1861700Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries)
  8. 1861704Domain d4bmxa_: 4bmx A: [227831]
    automated match to d4f2wb_
    complexed with ade, trs

Details for d4bmxa_

PDB Entry: 4bmx (more details), 1.76 Å

PDB Description: Native structure of futalosine hydrolase of Helicobacter pylori strain 26695
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4bmxa_:

Sequence, based on SEQRES records: (download)

>d4bmxa_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
hmvqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhst
ltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesa
ifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegas
vafvcqkfgvpccvlrsisdnadeeanmsfdafleksaqtsakflksmvdel

Sequence, based on observed residues (ATOM records): (download)

>d4bmxa_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
hmvqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhst
ltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesa
ifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegas
vafvcqkfgvpccvlrsisdnsfdafleksaqtsakflksmvdel

SCOPe Domain Coordinates for d4bmxa_:

Click to download the PDB-style file with coordinates for d4bmxa_.
(The format of our PDB-style files is described here.)

Timeline for d4bmxa_: