Lineage for d4bmzb_ (4bmz B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375959Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1375960Protein automated matches [190781] (23 species)
    not a true protein
  7. 1376025Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries)
  8. 1376032Domain d4bmzb_: 4bmz B: [227829]
    automated match to d4f2pb_
    complexed with mta; mutant

Details for d4bmzb_

PDB Entry: 4bmz (more details), 1.79 Å

PDB Description: Structure of futalosine hydrolase mutant of Helicobacter pylori strain 26695
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4bmzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmzb_ c.56.2.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
gshmvqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvh
stltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipe
saifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemeg
asvafvcqkfgvpccvlrsisnnadeeanmsfdafleksaqtsakflksmvdel

SCOPe Domain Coordinates for d4bmzb_:

Click to download the PDB-style file with coordinates for d4bmzb_.
(The format of our PDB-style files is described here.)

Timeline for d4bmzb_: