Lineage for d4b97a1 (4b97 A:3-151)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377160Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2377161Protein automated matches [191113] (12 species)
    not a true protein
  7. 2377192Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)
  8. 2377196Domain d4b97a1: 4b97 A:3-151 [227826]
    Other proteins in same PDB: d4b97a2
    automated match to d4b9fb_
    complexed with ca

Details for d4b97a1

PDB Entry: 4b97 (more details), 1.28 Å

PDB Description: Biomass sensing modules from putative Rsgi-like proteins of Clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
PDB Compounds: (A:) cellulose binding domain-containing protein

SCOPe Domain Sequences for d4b97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b97a1 b.2.2.0 (A:3-151) automated matches {Clostridium thermocellum [TaxId: 1515]}
svkvrfynnntlsetgviymrinvintgnapldlsdlklryyytidseseqrfncdwssi
gahnvtgsfgkvnpsrngadtyveigftkeagmlqpgesvelnarfsktdntqynkaddy
sfnshyyeyvdwdritayisgilkwgrep

SCOPe Domain Coordinates for d4b97a1:

Click to download the PDB-style file with coordinates for d4b97a1.
(The format of our PDB-style files is described here.)

Timeline for d4b97a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b97a2