SCOPe 2.07: Domain d4b97a1: 4b97 A:3-151

Lineage for d4b97a1 (4b97 A:3-151)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (12 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)

8. Domain d4b97a1: 4b97 A:3-151 [227826]
   Other proteins in same PDB: d4b97a2
   automated match to d4b9fb_
   complexed with ca

Details for d4b97a1

PDB Entry: 4b97, 1.28 Å

PDB Description: Biomass sensing modules from putative Rsgi-like proteins of Clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome

PDB Compounds: (A:) cellulose binding domain-containing protein

SCOPe Domain Sequences for d4b97a1:

Sequence; same for both SEQRES and ATOM records:

>d4b97a1 b.2.2.0 (A:3-151) automated matches {Clostridium thermocellum [TaxId: 1515]}
svkvrfynnntlsetgviymrinvintgnapldlsdlklryyytidseseqrfncdwssi
gahnvtgsfgkvnpsrngadtyveigftkeagmlqpgesvelnarfsktdntqynkaddy
sfnshyyeyvdwdritayisgilkwgrep

Timeline for d4b97a1:

• d4b97a1 first appeared in SCOPe 2.03, called d4b97a_
  
• d4b97a1 appears in SCOPe 2.06
  
• d4b97a1 appears in the current release, SCOPe 2.08