SCOPe 2.03: Domain d4b97a_: 4b97 A:

Lineage for d4b97a_ (4b97 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (5 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (7 PDB entries)

8. Domain d4b97a_: 4b97 A: [227826]
   automated match to d4b9fb_
   complexed with ca

Details for d4b97a_

PDB Entry: 4b97, 1.28 Å

PDB Description: Biomass sensing modules from putative Rsgi-like proteins of Clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome

PDB Compounds: (A:) cellulose binding domain-containing protein

SCOPe Domain Sequences for d4b97a_:

Sequence; same for both SEQRES and ATOM records:

>d4b97a_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
mgsvkvrfynnntlsetgviymrinvintgnapldlsdlklryyytidseseqrfncdws
sigahnvtgsfgkvnpsrngadtyveigftkeagmlqpgesvelnarfsktdntqynkad
dysfnshyyeyvdwdritayisgilkwgrep

Timeline for d4b97a_:

• d4b97a_ is new in SCOPe 2.03-stable
  
• d4b97a_ appears in SCOPe 2.04
  
• d4b97a_ appears in the current release, SCOPe 2.08, called d4b97a1