SCOPe 2.08: Domain d4b9ca1: 4b9c A:5-150

Lineage for d4b9ca1 (4b9c A:5-150)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [194259] (5 PDB entries)

8. Domain d4b9ca1: 4b9c A:5-150 [227825]
   Other proteins in same PDB: d4b9ca2
   automated match to d4b9fb_
   complexed with ca

Details for d4b9ca1

PDB Entry: 4b9c, 1.17 Å

PDB Description: Biomass sensoring modules from putative Rsgi-like proteins of Clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome

PDB Compounds: (A:) type 3a cellulose-binding domain protein

SCOPe Domain Sequences for d4b9ca1:

Sequence; same for both SEQRES and ATOM records:

>d4b9ca1 b.2.2.0 (A:5-150) automated matches {Clostridium thermocellum [TaxId: 203119]}
glkiqyysrkphdsagidfsfrmfntgneaidlkdvkvryyfkedvsidemnwavyfysl
gsekdvqcrfyelpgkkeankyleitfksgtlspndvmyitgefykndwtkfeqrddysy
npadsysdwkrmtayisnklvwgiep

Timeline for d4b9ca1:

• d4b9ca1 first appeared in SCOPe 2.03, called d4b9ca_
  
• d4b9ca1 appears in SCOPe 2.07