![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries) |
![]() | Domain d3wd8a2: 3wd8 A:236-389 [227820] Other proteins in same PDB: d3wd8a3, d3wd8b3, d3wd8c3, d3wd8d3 automated match to d1bi5a2 complexed with gol |
PDB Entry: 3wd8 (more details), 2.46 Å
SCOPe Domain Sequences for d3wd8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wd8a2 c.95.1.0 (A:236-389) automated matches {Citrus microcarpa [TaxId: 164113]} lfhvvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavspfgisdw nslfysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfildeirkksmq eakpttgdglewgvlfaigpgltvetvillsvpi
Timeline for d3wd8a2: