SCOPe 2.03: Domain d3vwvb_: 3vwv B:

Lineage for d3vwvb_ (3vwv B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (5 PDB entries)

8. Domain d3vwvb_: 3vwv B: [227811]
   automated match to d2pn8a_
   complexed with 1pe, acy

Details for d3vwvb_

PDB Entry: 3vwv, 1.8 Å

PDB Description: crystal structure of N-terminally truncated peroxiredoxin 4 from M. musculus

PDB Compounds: (B:) Peroxiredoxin-4

SCOPe Domain Sequences for d3vwvb_:

Sequence; same for both SEQRES and ATOM records:

>d3vwvb_ c.47.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hssglvprgshmpapywegtavingefkelkltdyrgkylvfffypldftfvcpteiiaf
gdrieefksintevvacsvdsqfthlawintprrqgglgpiripllsdlnhqiskdygvy
ledsghtlrglfiiddkgvlrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkp
gse

Timeline for d3vwvb_:

• d3vwvb_ is new in SCOPe 2.03-stable
  
• d3vwvb_ appears in SCOPe 2.04
  
• d3vwvb_ appears in the current release, SCOPe 2.08, called d3vwvb1