Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries) |
Domain d3vwvb1: 3vwv B:87-257 [227811] Other proteins in same PDB: d3vwva2, d3vwvb2 automated match to d2pn8a_ complexed with 1pe, acy |
PDB Entry: 3vwv (more details), 1.8 Å
SCOPe Domain Sequences for d3vwvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vwvb1 c.47.1.0 (B:87-257) automated matches {Mouse (Mus musculus) [TaxId: 10090]} papywegtavingefkelkltdyrgkylvfffypldftfvcpteiiafgdrieefksint evvacsvdsqfthlawintprrqgglgpiripllsdlnhqiskdygvyledsghtlrglf iiddkgvlrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
Timeline for d3vwvb1: