SCOPe 2.05: Domain d4mfgd_: 4mfg D:

Lineage for d4mfgd_ (4mfg D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [193268] (3 PDB entries)

8. Domain d4mfgd_: 4mfg D: [227805]
   automated match to d1xhda_
   complexed with mg, ni

Details for d4mfgd_

PDB Entry: 4mfg, 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of putative carbonic anhydrase from clostridium difficile.

PDB Compounds: (D:) Putative acyltransferase

SCOPe Domain Sequences for d4mfgd_:

Sequence; same for both SEQRES and ATOM records:

>d4mfgd_ b.81.1.0 (D:) automated matches {Clostridium difficile [TaxId: 272563]}
snamirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentni
qdcsivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtl
itsnkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky

Timeline for d4mfgd_:

• d4mfgd_ first appeared in SCOPe 2.03
  
• d4mfgd_ appears in SCOPe 2.04
  
• d4mfgd_ is called d4mfgd1 in SCOPe 2.06
  
• d4mfgd_ appears in the current release, SCOPe 2.08, called d4mfgd1