Lineage for d4mfgd_ (4mfg D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329958Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329959Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1330233Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1330234Protein automated matches [190967] (25 species)
    not a true protein
  7. 1330277Species Clostridium difficile [TaxId:272563] [193268] (3 PDB entries)
  8. 1330281Domain d4mfgd_: 4mfg D: [227805]
    automated match to d1xhda_
    complexed with mg, ni

Details for d4mfgd_

PDB Entry: 4mfg (more details), 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of putative carbonic anhydrase from clostridium difficile.
PDB Compounds: (D:) Putative acyltransferase

SCOPe Domain Sequences for d4mfgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mfgd_ b.81.1.0 (D:) automated matches {Clostridium difficile [TaxId: 272563]}
snamirdyledkplidesvfvaksadvignvkigkdssiwynavvrgdegpitigentni
qdcsivhgdtetiignnvtvghrsivhgckisdnvligmgsiildnaeigeytligagtl
itsnkkfppgvlimgspgkvvrelteedkkyidesyewyleaaqnqky

SCOPe Domain Coordinates for d4mfgd_:

Click to download the PDB-style file with coordinates for d4mfgd_.
(The format of our PDB-style files is described here.)

Timeline for d4mfgd_:

  • d4mfgd_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d4mfgd_ appears in SCOPe 2.04
  • d4mfgd_ appears in the current release, SCOPe 2.07, called d4mfgd1