Lineage for d4mcca_ (4mcc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884718Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 1884731Protein automated matches [196235] (1 species)
    not a true protein
  7. 1884732Species Haemophilus influenzae [TaxId:71421] [196236] (7 PDB entries)
  8. 1884737Domain d4mcca_: 4mcc A: [227801]
    automated match to d1uaja_
    complexed with 21x

Details for d4mcca_

PDB Entry: 4mcc (more details), 1.95 Å

PDB Description: hintrmd in complex with n-[4-(aminomethyl)benzyl]-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4mcca_:

Sequence, based on SEQRES records: (download)

>d4mcca_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlr

Sequence, based on observed residues (ATOM records): (download)

>d4mcca_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlglldcphytrpevlegltvp
pvlmsghheeirkwrlkqslqrtwlr

SCOPe Domain Coordinates for d4mcca_:

Click to download the PDB-style file with coordinates for d4mcca_.
(The format of our PDB-style files is described here.)

Timeline for d4mcca_: