Lineage for d3pcdo_ (3pcd O:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035756Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2035757Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 protein domains)
    sandwich; 9 strands in 2 sheets
  6. 2035966Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2035981Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2036077Domain d3pcdo_: 3pcd O: [22780]
    Other proteins in same PDB: d3pcda_, d3pcdb_, d3pcdc_, d3pcdd_, d3pcde_, d3pcdf_
    complexed with bme, co3, fe; mutant

Details for d3pcdo_

PDB Entry: 3pcd (more details), 2.1 Å

PDB Description: protocatechuate 3,4-dioxygenase y447h mutant
PDB Compounds: (O:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcdo_:

Sequence, based on SEQRES records: (download)

>d3pcdo_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcdo_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgphpwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pcdo_:

Click to download the PDB-style file with coordinates for d3pcdo_.
(The format of our PDB-style files is described here.)

Timeline for d3pcdo_: