| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
| Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
| Protein automated matches [190891] (38 species) not a true protein |
| Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (8 PDB entries) |
| Domain d4mb6a_: 4mb6 A: [227798] automated match to d2dy0a_ complexed with na |
PDB Entry: 4mb6 (more details), 1.81 Å
SCOPe Domain Sequences for d4mb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mb6a_ c.61.1.0 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
vsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvt
kvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqp
gdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslv
sfd
Timeline for d4mb6a_: