SCOPe 2.07: Domain d4m1dh2: 4m1d H:114-213

Lineage for d4m1dh2 (4m1d H:114-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d4m1dh2: 4m1d H:114-213 [227792]
   Other proteins in same PDB: d4m1dh1, d4m1di1, d4m1dl1, d4m1dl2, d4m1dm1, d4m1dm2
   automated match to d1q1jh2
   complexed with gol

Details for d4m1dh2

PDB Entry: 4m1d, 1.8 Å

PDB Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN

PDB Compounds: (H:) Fab mAb 447-52D Heavy Chain

SCOPe Domain Sequences for d4m1dh2:

Sequence; same for both SEQRES and ATOM records:

>d4m1dh2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel

Timeline for d4m1dh2:

• d4m1dh2 first appeared in SCOPe 2.03
  
• d4m1dh2 appears in SCOPe 2.06
  
• d4m1dh2 appears in the current release, SCOPe 2.08