SCOPe 2.03: Domain d4m8ia2: 4m8i A:209-321

Lineage for d4m8ia2 (4m8i A:209-321)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (4 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176279] [227789] (1 PDB entry)

8. Domain d4m8ia2: 4m8i A:209-321 [227790]
   Other proteins in same PDB: d4m8ia1
   automated match to d4dxda2
   complexed with gdp, so4

Details for d4m8ia2

PDB Entry: 4m8i, 1.43 Å

PDB Description: 1.43 angstrom resolution crystal structure of cell division protein ftsz (ftsz) from staphylococcus epidermidis rp62a in complex with gdp

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d4m8ia2:

Sequence; same for both SEQRES and ATOM records:

>d4m8ia2 d.79.2.0 (A:209-321) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfedkpss

Timeline for d4m8ia2:

• d4m8ia2 is new in SCOPe 2.03-stable
  
• d4m8ia2 appears in SCOPe 2.04
  
• d4m8ia2 appears in the current release, SCOPe 2.08