Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries) |
Domain d4l5lb2: 4l5l B:81-217 [227769] Other proteins in same PDB: d4l5la1, d4l5lb1 automated match to d3isoa2 complexed with gsh, mes, zn |
PDB Entry: 4l5l (more details), 2.2 Å
SCOPe Domain Sequences for d4l5lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l5lb2 a.45.1.0 (B:81-217) automated matches {Clonorchis sinensis [TaxId: 79923]} migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik wplngwsayfgggdapp
Timeline for d4l5lb2: