![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (107 species) not a true protein |
![]() | Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries) |
![]() | Domain d4l5lb1: 4l5l B:1-80 [227768] Other proteins in same PDB: d4l5la2, d4l5lb2 automated match to d3isoa1 complexed with gsh, mes, zn |
PDB Entry: 4l5l (more details), 2.2 Å
SCOPe Domain Sequences for d4l5lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l5lb1 c.47.1.0 (B:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]} mapvlgywkirglaqpirllleyvgdsyeehsygrcdgekwqndkhnlglelpnlpyykd gnfsltqslailryiadkhn
Timeline for d4l5lb1: