Lineage for d4l5lb1 (4l5l B:1-80)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370350Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries)
  8. 1370357Domain d4l5lb1: 4l5l B:1-80 [227768]
    Other proteins in same PDB: d4l5la2, d4l5lb2
    automated match to d3isoa1
    complexed with gsh, mes, zn

Details for d4l5lb1

PDB Entry: 4l5l (more details), 2.2 Å

PDB Description: crystal structure of 26 kda gst of clonorchis sinensis in p212121 symmetry
PDB Compounds: (B:) putative glutathione transferase

SCOPe Domain Sequences for d4l5lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l5lb1 c.47.1.0 (B:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]}
mapvlgywkirglaqpirllleyvgdsyeehsygrcdgekwqndkhnlglelpnlpyykd
gnfsltqslailryiadkhn

SCOPe Domain Coordinates for d4l5lb1:

Click to download the PDB-style file with coordinates for d4l5lb1.
(The format of our PDB-style files is described here.)

Timeline for d4l5lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l5lb2