Lineage for d4l5la2 (4l5l A:81-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327072Species Clonorchis sinensis [TaxId:79923] [225958] (3 PDB entries)
  8. 2327078Domain d4l5la2: 4l5l A:81-217 [227767]
    Other proteins in same PDB: d4l5la1, d4l5lb1
    automated match to d3isoa2
    complexed with gsh, mes, zn

Details for d4l5la2

PDB Entry: 4l5l (more details), 2.2 Å

PDB Description: crystal structure of 26 kda gst of clonorchis sinensis in p212121 symmetry
PDB Compounds: (A:) putative glutathione transferase

SCOPe Domain Sequences for d4l5la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l5la2 a.45.1.0 (A:81-217) automated matches {Clonorchis sinensis [TaxId: 79923]}
migntpverakismiegglvdlragvsriayqetfeqlkvpylqqlpstlrmwsqflgnn
sylhgstpthldfmfyealdviryldptsveafpnlmqfihriealpnikafmesdrfik
wplngwsayfgggdapp

SCOPe Domain Coordinates for d4l5la2:

Click to download the PDB-style file with coordinates for d4l5la2.
(The format of our PDB-style files is described here.)

Timeline for d4l5la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l5la1