SCOPe 2.07: Domain d4l5la1: 4l5l A:1-80

Lineage for d4l5la1 (4l5l A:1-80)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Clonorchis sinensis [TaxId:79923] [225957] (3 PDB entries)

8. Domain d4l5la1: 4l5l A:1-80 [227766]
   Other proteins in same PDB: d4l5la2, d4l5lb2
   automated match to d3isoa1
   complexed with gsh, mes, zn

Details for d4l5la1

PDB Entry: 4l5l, 2.2 Å

PDB Description: crystal structure of 26 kda gst of clonorchis sinensis in p212121 symmetry

PDB Compounds: (A:) putative glutathione transferase

SCOPe Domain Sequences for d4l5la1:

Sequence; same for both SEQRES and ATOM records:

>d4l5la1 c.47.1.0 (A:1-80) automated matches {Clonorchis sinensis [TaxId: 79923]}
mapvlgywkirglaqpirllleyvgdsyeehsygrcdgekwqndkhnlglelpnlpyykd
gnfsltqslailryiadkhn

Timeline for d4l5la1:

• d4l5la1 first appeared in SCOPe 2.03
  
• d4l5la1 appears in SCOPe 2.06
  
• d4l5la1 appears in the current release, SCOPe 2.08