Lineage for d4kyta3 (4kyt A:344-360,A:600-750)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1393994Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
    interrupted by a large insertion, domain N
  6. 1393995Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 1393996Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (37 PDB entries)
    Uniprot P04191
  8. 1394038Domain d4kyta3: 4kyt A:344-360,A:600-750 [227756]
    Other proteins in same PDB: d4kyta1, d4kyta2, d4kyta4
    automated match to d1wpga2
    complexed with k, mal

Details for d4kyta3

PDB Entry: 4kyt (more details), 2.83 Å

PDB Description: the structure of superinhibitory phospholamban bound to the calcium pump serca1a
PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d4kyta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kyta3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d4kyta3:

Click to download the PDB-style file with coordinates for d4kyta3.
(The format of our PDB-style files is described here.)

Timeline for d4kyta3: