| Class b: All beta proteins [48724] (174 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) ![]() a distorted variant of double-helix |
| Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
| Protein Calcium ATPase, transduction domain A [81651] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (37 PDB entries) Uniprot P04191 |
| Domain d4kyta2: 4kyt A:125-239 [227755] Other proteins in same PDB: d4kyta1, d4kyta3, d4kyta4 automated match to d1wpga1 complexed with k, mal |
PDB Entry: 4kyt (more details), 2.83 Å
SCOPe Domain Sequences for d4kyta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kyta2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d4kyta2: