Lineage for d4kn3a_ (4kn3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688404Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)
  8. 2688463Domain d4kn3a_: 4kn3 A: [227753]
    automated match to d3lb2a_
    complexed with hem, so4, t6c; mutant

Details for d4kn3a_

PDB Entry: 4kn3 (more details), 1.78 Å

PDB Description: structure of the y34ns91g double mutant of dehaloperoxidase from amphitrite ornata with 2,4,6-trichlorophenol
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4kn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kn3a_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d4kn3a_:

Click to download the PDB-style file with coordinates for d4kn3a_.
(The format of our PDB-style files is described here.)

Timeline for d4kn3a_: