![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries) Uniprot P01887 |
![]() | Domain d4irsb_: 4irs B: [227740] Other proteins in same PDB: d4irsa1, d4irsa2, d4irsc1, d4irsc2, d4irsd1, d4irsd2 automated match to d1p4lb_ complexed with 1la, nag |
PDB Entry: 4irs (more details), 2.8 Å
SCOPe Domain Sequences for d4irsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irsb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d4irsb_: