SCOPe 2.08: Domain d4irsd1: 4irs D:2-112

Lineage for d4irsd1 (4irs D:2-112)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
Domain d4irsd1: 4irs D:2-112 [227733]
Other proteins in same PDB: d4irsa1, d4irsa2, d4irsb_, d4irsc1, d4irsc2, d4irsd2
automated match to d3o8xd1
complexed with 1la, nag

Details for d4irsd1

PDB Entry: 4irs (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-pyrc-alpha-galcer-inkt tcr complex

PDB Compounds: (D:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irsd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4irsd1:

Click to download the PDB-style file with coordinates for d4irsd1.
(The format of our PDB-style files is described here.)

Timeline for d4irsd1: