Lineage for d4irsd1 (4irs D:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744922Domain d4irsd1: 4irs D:2-112 [227733]
    Other proteins in same PDB: d4irsa1, d4irsa2, d4irsb_, d4irsc1, d4irsc2, d4irsd2
    automated match to d3o8xd1
    complexed with 1la, nag

Details for d4irsd1

PDB Entry: 4irs (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-pyrc-alpha-galcer-inkt tcr complex
PDB Compounds: (D:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irsd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d4irsd1:

Click to download the PDB-style file with coordinates for d4irsd1.
(The format of our PDB-style files is described here.)

Timeline for d4irsd1: