![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (202 PDB entries) |
![]() | Domain d4irsd1: 4irs D:2-112 [227733] Other proteins in same PDB: d4irsa1, d4irsa2, d4irsb_, d4irsc1, d4irsc2, d4irsd2 automated match to d3o8xd1 complexed with 1la, ful, nag |
PDB Entry: 4irs (more details), 2.8 Å
SCOPe Domain Sequences for d4irsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irsd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle
Timeline for d4irsd1: