Lineage for d4jhba_ (4jhb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770170Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 1770274Protein automated matches [226855] (1 species)
    not a true protein
  7. 1770275Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)
  8. 1770278Domain d4jhba_: 4jhb A: [227726]
    automated match to d1zk9a_
    mutant

Details for d4jhba_

PDB Entry: 4jhb (more details), 2.44 Å

PDB Description: Crystal structure of RelB double mutants: Y300F/I335F
PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d4jhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jhba_ b.1.18.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvprgshmntselricrinkesgpctggeelfllcdkvqkedisvvfstaswegradfsq
advhrqfaivfktppyedleisepvtvnvflqrltdgvcseplpftylpr

SCOPe Domain Coordinates for d4jhba_:

Click to download the PDB-style file with coordinates for d4jhba_.
(The format of our PDB-style files is described here.)

Timeline for d4jhba_: