Lineage for d4ja2a_ (4ja2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115385Species Thermotoga maritima [TaxId:243274] [227724] (2 PDB entries)
  8. 2115386Domain d4ja2a_: 4ja2 A: [227725]
    automated match to d4h60a_
    complexed with act, mg, so4; mutant

Details for d4ja2a_

PDB Entry: 4ja2 (more details), 1.79 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (RR468mutant V13P, L14I, I17M and N21V)
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d4ja2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ja2a_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg
ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
e

SCOPe Domain Coordinates for d4ja2a_:

Click to download the PDB-style file with coordinates for d4ja2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ja2a_: