SCOPe 2.04: Domain d4irsc1: 4irs C:1-114

Lineage for d4irsc1 (4irs C:1-114)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4irsc1: 4irs C:1-114 [227716]
   Other proteins in same PDB: d4irsa1, d4irsa2, d4irsb_, d4irsc2, d4irsd1, d4irsd2
   automated match to d3o8xc1
   complexed with 1la, nag

Details for d4irsc1

PDB Entry: 4irs, 2.8 Å

PDB Description: structure of the mouse cd1d-pyrc-alpha-galcer-inkt tcr complex

PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irsc1:

Sequence; same for both SEQRES and ATOM records:

>d4irsc1 b.1.1.0 (C:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d4irsc1:

• d4irsc1 first appeared in SCOPe 2.03
  
• d4irsc1 appears in SCOPe 2.05
  
• d4irsc1 appears in the current release, SCOPe 2.08