Lineage for d4jaua1 (4jau A:238-320)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732492Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1732532Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 1732545Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 1732546Protein automated matches [227713] (2 species)
    not a true protein
  7. 1732550Species Thermotoga maritima [TaxId:243274] [227714] (4 PDB entries)
  8. 1732551Domain d4jaua1: 4jau A:238-320 [227715]
    Other proteins in same PDB: d4jaua2
    automated match to d2c2aa1
    complexed with adp; mutant

Details for d4jaua1

PDB Entry: 4jau (more details), 2.7 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E)
PDB Compounds: (A:) Histidine kinase

SCOPe Domain Sequences for d4jaua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaua1 a.30.2.0 (A:238-320) automated matches {Thermotoga maritima [TaxId: 243274]}
skelerlkridrmktefianishelrtpltvikgyaemiynslgeldlstlkefletiie
qsnhlenllnelldfsrlerksl

SCOPe Domain Coordinates for d4jaua1:

Click to download the PDB-style file with coordinates for d4jaua1.
(The format of our PDB-style files is described here.)

Timeline for d4jaua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jaua2