SCOPe 2.08: Domain d4jaua1: 4jau A:238-320

Lineage for d4jaua1 (4jau A:238-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries)

8. Domain d4jaua1: 4jau A:238-320 [227715]
   Other proteins in same PDB: d4jaua2
   automated match to d2c2aa1
   complexed with adp; mutant

Details for d4jaua1

PDB Entry: 4jau, 2.7 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E)

PDB Compounds: (A:) Histidine kinase

SCOPe Domain Sequences for d4jaua1:

Sequence; same for both SEQRES and ATOM records:

>d4jaua1 a.30.2.0 (A:238-320) automated matches {Thermotoga maritima [TaxId: 243274]}
skelerlkridrmktefianishelrtpltvikgyaemiynslgeldlstlkefletiie
qsnhlenllnelldfsrlerksl

Timeline for d4jaua1:

• d4jaua1 first appeared in SCOPe 2.03
  
• d4jaua1 appears in SCOPe 2.07