Lineage for d4gu6a_ (4gu6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930471Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1930475Species Human (Homo sapiens) [TaxId:9606] [103293] (15 PDB entries)
  8. 1930480Domain d4gu6a_: 4gu6 A: [227709]
    automated match to d3pxkb_
    complexed with 10n

Details for d4gu6a_

PDB Entry: 4gu6 (more details), 1.95 Å

PDB Description: focal adhesion kinase catalytic domain in complex with n-{3-[(5-cyano-2-phenyl-1h-pyrrolo[2,3-b]pyridin-4-ylamino)- methyl]-pyridin-2-yl}-n-methyl-methanesulfonamide
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4gu6a_:

Sequence, based on SEQRES records: (download)

>d4gu6a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapes
infrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlys
lmtkcwaydpsrrprftelkaqlstileeekaq

Sequence, based on observed residues (ATOM records): (download)

>d4gu6a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
dyeiqrerielgrcigegqfgdvhqgiymsnpalavaiktcknctsdsvrekflqealtm
rqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstala
yleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesin
frrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslm
tkcwaydpsrrprftelkaqlstileeekaq

SCOPe Domain Coordinates for d4gu6a_:

Click to download the PDB-style file with coordinates for d4gu6a_.
(The format of our PDB-style files is described here.)

Timeline for d4gu6a_: