Lineage for d4h4la_ (4h4l A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009431Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 3009432Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 3009433Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 3009434Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 3009435Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
    Uniprot P10943
  8. 3009454Domain d4h4la_: 4h4l A: [227698]
    automated match to d2zh0b_
    protein/RNA complex; complexed with his, zn

Details for d4h4la_

PDB Entry: 4h4l (more details), 2.5 Å

PDB Description: crystal structure of ternary complex of hutp(hutp-l-his-zn)
PDB Compounds: (A:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d4h4la_:

Sequence, based on SEQRES records: (download)

>d4h4la_ d.275.1.1 (A:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

Sequence, based on observed residues (ATOM records): (download)

>d4h4la_ d.275.1.1 (A:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllnetqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

SCOPe Domain Coordinates for d4h4la_:

Click to download the PDB-style file with coordinates for d4h4la_.
(The format of our PDB-style files is described here.)

Timeline for d4h4la_: