Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (28 species) not a true protein |
Species Streptococcus agalactiae [TaxId:208435] [227693] (1 PDB entry) |
Domain d4h0fa_: 4h0f A: [227694] automated match to d3ztta_ complexed with zn; mutant |
PDB Entry: 4h0f (more details), 2.4 Å
SCOPe Domain Sequences for d4h0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0fa_ c.92.2.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 208435]} gmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhshtl eawardldpnlkkskvnvfeaskpltldrvkpgatvydphtwtdpvlageeavniakelg hldpkhkdsytkkakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlg isgispeqepsprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlsplea apsgnktylenlranlevlyqqlk
Timeline for d4h0fa_: