Lineage for d4h0fa_ (4h0f A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878032Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1878139Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1878387Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 1878388Protein automated matches [190944] (28 species)
    not a true protein
  7. 1878475Species Streptococcus agalactiae [TaxId:208435] [227693] (1 PDB entry)
  8. 1878476Domain d4h0fa_: 4h0f A: [227694]
    automated match to d3ztta_
    complexed with zn; mutant

Details for d4h0fa_

PDB Entry: 4h0f (more details), 2.4 Å

PDB Description: mutant structure of laminin-binding adhesin (lmb) from streptococcus agalactiae
PDB Compounds: (A:) Laminin-binding surface protein

SCOPe Domain Sequences for d4h0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0fa_ c.92.2.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 208435]}
gmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhshtl
eawardldpnlkkskvnvfeaskpltldrvkpgatvydphtwtdpvlageeavniakelg
hldpkhkdsytkkakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlg
isgispeqepsprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlsplea
apsgnktylenlranlevlyqqlk

SCOPe Domain Coordinates for d4h0fa_:

Click to download the PDB-style file with coordinates for d4h0fa_.
(The format of our PDB-style files is described here.)

Timeline for d4h0fa_: