![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (22 species) not a true protein |
![]() | Species Medicago truncatula [TaxId:3880] [194255] (7 PDB entries) |
![]() | Domain d4gy9a1: 4gy9 A:1-158 [227692] Other proteins in same PDB: d4gy9a2 automated match to d4jhga_ complexed with mli, na, zip |
PDB Entry: 4gy9 (more details), 2.04 Å
SCOPe Domain Sequences for d4gy9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gy9a1 d.129.3.0 (A:1-158) automated matches {Medicago truncatula [TaxId: 3880]} mgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtikkltfv gdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivksttky ytkgddielskdyleagierfegftkavesfllanpdy
Timeline for d4gy9a1: